SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011071 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011071
Domain Number 1 Region: 403-598
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.59e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000459
Further Details:      
 
Domain Number 2 Region: 219-331
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-20
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 16-52
Classification Level Classification E-value
Superfamily WW domain 0.0000000306
Family WW domain 0.0028
Further Details:      
 
Domain Number 4 Region: 117-146
Classification Level Classification E-value
Superfamily WW domain 0.0000104
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011071   Gene: ENSEEUG00000012124   Transcript: ENSEEUT00000012138
Sequence length 600
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6352:3871:37353:-1 gene:ENSEEUG00000012124 transcript:ENSEEUT00000012138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELKLLQSLLSSLPGSPAIQVNGEWETHRDGSGRCYYYHRGTQERTWKPPRWTRGTDMSK
GDFPGPGDQELLSSEEHHPGLCFSQSDSQCGSPPRGWSEEQDECGHTLYTSDYTHEKWLK
HVDDQGRQYYYSADGSRSEWELPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLEKYGLLNVTKITENGKKVRKNW
LSSWAVLQGSSLLFTKTQGSGTSWFGSNQSKPEFTVDLKGATVEMASKEKSSKKNVFELK
TRQGTELLIQSDNDSAINDWFKVLSSTISNQAVETEDAIDEEMPDSPGAEKRDREKEHKD
PRKLRSMKTVNVDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSSLASLCQREN
STVPEFVKLCIEHVENHGLDIDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVV
TGALKMFFRELPEPLFPFSHFNDFVNAVKQEPRQRVTAVKDLIKQLPKPNQDTMQILFRH
LKRVIENGEKNRMTYQSVAIVFGPTLLKPEKETGNIAVHTVYQSQIVELILLELSSIFGR
Download sequence
Identical sequences ENSEEUP00000011071 ENSEEUP00000011071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]