SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011163 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011163
Domain Number 1 Region: 39-662,809-875
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.32e-228
Family Motor proteins 0.000000000882
Further Details:      
 
Domain Number 2 Region: 1876-1992
Classification Level Classification E-value
Superfamily Second domain of FERM 9.29e-20
Family Second domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 1281-1383
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000288
Family Second domain of FERM 0.0061
Further Details:      
 
Domain Number 4 Region: 1777-1884
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000294
Family Ras-binding domain, RBD 0.05
Further Details:      
 
Domain Number 5 Region: 1993-2079
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000934
Family Third domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011163   Gene: ENSEEUG00000012131   Transcript: ENSEEUT00000012238
Sequence length 2097
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6860:5642:108653:1 gene:ENSEEUG00000012131 transcript:ENSEEUT00000012238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDHVWLEAPYVNKTNVAIGGIVKNTKPSKILVEDDEGKEHWIHADNLGALSHMHPNSAQG
VDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQALPLYTLEQVHLYYKRH
VGELPPHVFAIADNCYFNMKKNKKDQCCIISGESGAGKTETTKLILQFLATISGQHSWIE
QQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKSRVCRQA
TEERNYHIFYSMLMGMSAEEKRLLGLGTPSEYYYLTMGNCTSCEGLNDAKDYAHLRSAMK
ILMFSDSENWDLSKLLAAILHLGNVKFMAAVFENLDSSDVMETPSFAIVLKLLEXXXXXX
XXXXXXHSIAIRGEFVTRPLSVSQAADRRDAFVKGIYGHLFLWIVKKINAAIFVPPPDNP
KHVRRAIGLLDIFGFEIFKNSFEQLCINLANEHLQQFFVQHVFTMEQEEYRSENITWDYI
QYTDNRPTLDLLALKPMSIISLLDEESRFPQVCGTDATMLQKLNSVHANNKAFLQPKNVH
DGRFGIAHFAGKVHYHVEGFLEKNRDVLSSDILTLVHSSKNKFLQEIFKLEATEIKLGRG
TIFKTKAGSQLFKSSESSKQPSTLAGQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXIHMGFESLQAIARRHLLANQYQMMRHRVVQLQALCRG
YLVRQQMQVKRRAVVLLQAHARGMAARRKLQHLKVNXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTSKLNVGDDTFEPDGPISDR
XXXXXXXXXXXXXXXXXXXXXXDEVYCQICKQLSENFKTSSLARGWILLSLCLGCFPPSE
RFMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFWSLGSGRDHVMDAIAQC
EQLTRERGENERQSPWRLYFRKEFFTPWHNSQEDPVSTKLIYCQVLHGVWSGEYSFEKEE
DLIELLARHCYVQLGASVESQAVQELLPTCIPSKLYRTKLPEKWASLVTEAHAKAPYTQQ
QAKPQAVREQVVDAALLQWPMLFSRLFEVSTVSGPRLPKTQLILAVNWKGLYFLDKKEKL
LLELSFVEVMSLVTHREARGGQRLMLSTLHEEEYEFLSPSSVAIAELVALFLEGLKERSV
FTMAMQDRKATDDSAILTFRNGDLLIWTLAKRQNKRQRGAIGNEHXVPMASLYTIPTVTK
PSPWLLNLLAMSPEKRKLVVQEGRPAEPLPEEQPQEKSHTLEEFSYEFFRAPEKETVSRA
MLPLARTRGHLWAHSAEPLRQPLLKCVHANAFSLAATPILRYMGDYPARXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSEERGWQLLWLCTGLFPPGKALLPHVQKFI
DTRRKKPLAPDCSRRIQRVLRIGPRKQPPHQVEVEAIGKNVFRINHKVFFPNDTSEMLEV
SSSTRVRDVCESISAKLQLASWEGCSLFIKIADKVIIQNEGDFFIDSLREVSDWVKNNKP
QKEGGPMTLPYQVYFMRKLWLNVTPGKDVNADITLHYHQELPKYLRGFHKCTREDVVHLA
GLIYKAQYGNDRAQLASLPKILRELVPENLTRLMSSEEWRKSILLACEKHKDKTSEEAKV
DLLKWICRWPTFGSAFFEVKQSSEPSYPDIIIIAINRHGVLLIHPKTKELLTLPFKASWS
SGSTYFHMALGSLGHGSRLLCETSLGYKMDDLLTSYVQQLLNTLNKQRGSRAVALAE
Download sequence
Identical sequences ENSEEUP00000011163 ENSEEUP00000011163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]