SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011185 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011185
Domain Number 1 Region: 466-524
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000012
Family SH2 domain 0.0000626
Further Details:      
 
Domain Number 2 Region: 265-307
Classification Level Classification E-value
Superfamily PH domain-like 0.0000493
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011185   Gene: ENSEEUG00000012242   Transcript: ENSEEUT00000012261
Sequence length 525
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1857:5308:64446:-1 gene:ENSEEUG00000012242 transcript:ENSEEUT00000012261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQVEQTSSHRPHDLAGSGFRAQSDRLAHHQEDDVDLEALVNDMNTSLESLYSACPMQSET
TPLLQSSSHTRSQPRQPGPSASLPPRQKVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPN
PFPELCGPESPPVLSHGSLSPSQAAAKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN
FFPEQMVTWCQQANGSQTQLLQNFLNASSCPEIQGFLHVKDLGRKSWKKLYVCMRRSGLY
CSTKGASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXYGMLLYQNYRIPQQRKGLLSPFNTPVRSVSENSLVAMDFSGQ
TGRVIENPAEAQCAAMEEGHAWRXXXXXXXXXXXXXXXXXXXXXXXIHRTQLWFLVRIPE
ESHRLIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILP
Download sequence
Identical sequences ENSEEUP00000011185 ENSEEUP00000011185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]