SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011198 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011198
Domain Number 1 Region: 109-246
Classification Level Classification E-value
Superfamily PH domain-like 5.94e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000007
Family Phosphotyrosine-binding domain (PTB) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011198   Gene: ENSEEUG00000012287   Transcript: ENSEEUT00000012277
Sequence length 311
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8800:1219:161217:1 gene:ENSEEUG00000012287 transcript:ENSEEUT00000012277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVTELHNIKNITRLPRETRKHAVAI
IFQDETSKTFACESELEAEEWCKHLCMECLGTRLNDISLGEPDLLAAGVQREQNERFNVY
LMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMC
DTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLEMEQKARLQTRLMEPMTLSKSIS
LPRSAYWHHITRQNSEGEIYSLQGXXHNFGPSKMSRAQTFPSYTSEQSEETQQTLSRSSS
YGFSYSSSLIQ
Download sequence
Identical sequences ENSEEUP00000011198 ENSEEUP00000011198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]