SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011215 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011215
Domain Number 1 Region: 3-67,110-238,269-378,474-578
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.02e-22
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 
Domain Number 2 Region: 405-439
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000333
Family Ovomucoid domain III-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011215   Gene: ENSEEUG00000012264   Transcript: ENSEEUT00000012296
Sequence length 645
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7378:12728:142069:1 gene:ENSEEUG00000012264 transcript:ENSEEUT00000012296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGL
LLSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLDFICRSSTNMMYLLLIG
AQVLLGIGATPEQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVD
AVFIDTSSLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPLHSDPAMESEQA
MLPEREYEHPKPSNGVLRHPLEPDSSASCFQQLRXXXXXXXXXXXXXXXTCIILAACMIA
VAGFAAFLGKYLEQQFNLTTSSANQLLXXXXXXWAALDFSWGGFLVKRFTLFAQGAYRMG
MVVNLVSTPWLVSFPSLGCHTEPVAEFTVPYRNTSASGAALDPYSPCNKNCECQTDSFTP
VCGADGITYLSACFAGCNSTNLTGCACLTTIPPENATVVPGKCPSPGCQEAFLTFLCVMC
VCSMIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFW
STFCGEKGACALYDNVAYRYLYVSIAITLKAFAFLLYTTTWQCLRKNYKRYIKNHEGGLT
TSEFFASTLTLENLGRDPVPHQTHRTKFIYNLEDHEWCENMESVL
Download sequence
Identical sequences ENSEEUP00000011215 ENSEEUP00000011215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]