SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011291 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011291
Domain Number 1 Region: 207-323
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 568-724
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-21
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011291   Gene: ENSEEUG00000012372   Transcript: ENSEEUT00000012385
Sequence length 860
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5769:78432:111815:-1 gene:ENSEEUG00000012372 transcript:ENSEEUT00000012385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVPKKASKKFKFFKFKGFGSLSSLPRSFTLXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPQVLTNPPDMEAA
KEVVMETDAPLKDTPAVGPGPSAVKTDLEKKPEDTRADKRVESAPRNMSPEXXXXXXXXX
XXXXXFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDF
LIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYH
VGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLSQASSKVGSPASPSGSKGNHMKRRSI
TMTDGLTSDKVTRGDGCSASASLPHPRESIRNCALSMDQIPDLHSPMTPISESPSSPAYS
TVTRVHAAPAVPSATALPVSPVTRRSSEPQLCPGSAPKLPGELDKVSYTSPSHTLCNASP
SPSLSSYSDPDSGHYCQLQPPVRGSREWSASEASSQQTRSYGERLKELSESGASEGDWGR
AFTAPIVEATSSFNPATFQSLLIPKDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCL
VARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEE
RAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQIARLEQTWMTLRQRHTEGAILYEK
KLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPAEGPEPWGSTEHGVEVVLAHL
EAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASNSQVRRYEKF
DKVLTALSHKLEPAVHSSEL
Download sequence
Identical sequences ENSEEUP00000011291 ENSEEUP00000011291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]