SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011363 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011363
Domain Number 1 Region: 30-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.23e-39
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000188
Family VWC domain 0.007
Further Details:      
 
Domain Number 3 Region: 682-754
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000335
Family VWC domain 0.022
Further Details:      
 
Domain Number 4 Region: 427-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 400-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000487
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000178
Family VWC domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011363
Domain Number - Region: 627-687
Classification Level Classification E-value
Superfamily FnI-like domain 0.000146
Family VWC domain 0.029
Further Details:      
 
Domain Number - Region: 597-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 766-802
Classification Level Classification E-value
Superfamily FnI-like domain 0.0335
Family VWC domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011363   Gene: ENSEEUG00000012426   Transcript: ENSEEUT00000012459
Sequence length 810
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6428:6882:254923:1 gene:ENSEEUG00000012426 transcript:ENSEEUT00000012459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILRDTLMNVWLGMGTPRTVVGLGMDPDLQMDIVTELDLVNTTLGVTQVSGMHNGSKAFLF
QDVRREIHADPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVLLSIRELEHSYFELESSG
LRDEIRYHYMHGGKPRMEVLPFRMADGQWHRVALSVSASHVLLHVDCNRIYERVIDPPET
NLPPGSSVWLGQRNQKHGLFKGIIQDEKLIFMPNGYITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLNQLENCHCEKTCQVSGLLYRDQDTWVDGDHCRNCTCKSG
TVKCRRMSCPPLRCPLDSLPVHISGQCCKVCRPKCIYGGRVLAEGQRILTKSCRECRDGV
LVKLTEACSPLNCSEKDHILPENQCCSVCRGHNFCAEGPKCGENSECKNWNTKATCECKN
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GAGQHNCDQNAICTNTVLGHSCTCDPGYVGNGTICTXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDEC
ALRTHTCGSDSACVNLAGGFDCLCASGSSCSGDCPHEGGLRRNGQVWTLNDDRCSLCSCK
DGKIFCRRTACDCQNPSVDLFCCPECDTRVTSQCLDQDGHKFYRSGDSWTQNCQQCRCLE
GEVDCWPLTCPDLSCEYTAMSEGECCPRCVSDPCLADSLAYDIRKTCLDSYGISRLSGSV
WTMAGSACTTCKCKNGSVCCSVDLECLQNN
Download sequence
Identical sequences ENSEEUP00000011363 ENSEEUP00000011363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]