SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011394 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011394
Domain Number 1 Region: 87-184
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-24
Family SH2 domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011394   Gene: ENSEEUG00000012495   Transcript: ENSEEUT00000012496
Sequence length 380
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_276:1003:9120:-1 gene:ENSEEUG00000012495 transcript:ENSEEUT00000012496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPLAKAYSQECEAPTFSTFLPGMDLTQRNCQGTSLLPMCPQVLEAASIEGSVRMEELP
EGGMSLQAETRDWFQKTQAQCLLQNGAAPAWLHGFITRREAEKLLEPQPLGCYLVRFSES
AITFVLTYRSQTCCRHFLLAQLRDGRHVVLGEDRAHTRLQDLLQHYTGCPLSPYGETLTQ
PLARQTPEPAGLSLGTEEADSRSQSQDPYPPYSPVLKKEQPAAPTPKERVDEPKEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPSYQELHCENSEARQGQVPPRWGQTLPH
LSRQVLQDRGQAGPSLGPPQ
Download sequence
Identical sequences ENSEEUP00000011394 ENSEEUP00000011394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]