SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011505 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011505
Domain Number 1 Region: 551-639
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-20
Family Third domain of FERM 0.0036
Further Details:      
 
Domain Number 2 Region: 261-301
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000157
Family Second domain of FERM 0.0081
Further Details:      
 
Domain Number 3 Region: 465-550
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000523
Family Second domain of FERM 0.0061
Further Details:      
 
Domain Number 4 Region: 404-454
Classification Level Classification E-value
Superfamily PH domain-like 0.0000477
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011505   Gene: ENSEEUG00000012613   Transcript: ENSEEUT00000012625
Sequence length 664
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6715:8457:17228:1 gene:ENSEEUG00000012613 transcript:ENSEEUT00000012625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTATGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYH
VNKLSQSGEVGEPAGPDPGLDDLDAALNNLEVKLEGSAPTDVLDSLTTIPELKDNLRIFR
HRRPRKLTLKGYRQHWVLKXXXXXXXXXXXXXXXXXXXXXXXXXCEVVPDVNVSGQKFCI
KLLVPSPEGMSEIHLRCQDEQQYARWMAGCRLASKGRTMADSSYSSEVQAILAFLSLQRT
SGGSGSHPQGPDASTESLNPYGLVAPRYQRKLKAKQLTPRILEAHQNVAQLSLSEAQLRF
IQAWQSLPDFGISYFTVRFKGSRKDEILGIANNRLIRIDLSVGDVVKTWRFSNMRQWNVN
WDIRQVAIEFEEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGG
HEAF
Download sequence
Identical sequences ENSEEUP00000011505 ENSEEUP00000011505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]