SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011507 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011507
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000295
Family TFIIH domain 0.00012
Further Details:      
 
Domain Number 2 Region: 52-97
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000000275
Family BSD domain 0.0001
Further Details:      
 
Domain Number 3 Region: 134-181
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000654
Family BSD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011507   Gene: ENSEEUG00000012627   Transcript: ENSEEUT00000012627
Sequence length 424
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2170:5031:59056:1 gene:ENSEEUG00000012627 transcript:ENSEEUT00000012627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELE
EKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSAAVNHKQDVGISAAFL
ADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFH
RDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSANS
KSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQHEQNGEPSSTDGNCGDADSFQPAVKRA
KFQESIEYEDLGKNNAIKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIREEME
AYTPKLTQVLSSSAASSTIAALSPGGALMQGGTQQAINQMVPNGIQSELNHLYVAVGNFL
RHFW
Download sequence
Identical sequences ENSEEUP00000011507 ENSEEUP00000011507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]