SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011529 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011529
Domain Number 1 Region: 611-708
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-17
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 2 Region: 1066-1198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-17
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 3 Region: 716-779
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000466
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011529
Domain Number - Region: 52-114
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.006
Further Details:      
 
Domain Number - Region: 1213-1260
Classification Level Classification E-value
Superfamily PH domain-like 0.0118
Family Third domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 967-1044
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0455
Family Ubiquitin-related 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011529   Gene: ENSEEUG00000012586   Transcript: ENSEEUT00000012651
Sequence length 1336
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_439:136425:207718:1 gene:ENSEEUG00000012586 transcript:ENSEEUT00000012651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKQGQRRTRGGARVRARQESPRARGRDPWTPEVDSIMAELKVETRTSMDWQKRCLSLETQ
LFRFRQQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKVKLSNLKNVDSADS
LHRKYQELLKTLQDKDKLIHQLEAQLEKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLQMAPSGDLLVNHQGTPEQESPPSEPGPQPVWQDS
VSKLQVALQAVMPAPSPGSLHSKDCGFKADGPSEDSSSSLICPGEIEAKTIPPHLGREGS
PGQLCVKPPVPRHGSASWGEGLAPGQGGTLPGTKACARDGRPGSSLTLPKVWAPGTRQDS
IRLAKRHHSQPQVGPGGFDFRVIVEAGTLPAFHPSSLPKVEAPAELREEPEKMEMEEPSP
AGKRAERESSKAPGPELEVDLEINPPTPPLHRFPSWXXXXXXXXXXXXXXXXXXXXXXXX
XXXSSPPALGSPGGPFSGLVYKNLTVPVYTSLKGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXESLEKSGYLLKMGSRVKTWKHRWFVLRQGQIMYYKSPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLISEKKTYYLTADSPNLLEEWIRILQSLVKVQAMRPPALPQG
GAKPTVKGWLTKVKHGHSKLVWCALVGRTFYYYRSYEDKDTWLYHLTVAAGGSSAKVGTA
YEQLIGKLMDGEGDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCQLTLAP
LFLPQHHVLLYIKQQLQRHADPRNETGQYATYCQRAVERTLQTGEREARPSRMEVVSILL
RNPFHHSLPFSIPVHFTNGTYQVVGFVGSSTVDEFLQRLNQETGMRKTSHSGFALFMDDP
SGRDLEHCLQGSVKICDAISKWEQALKELHSGKSEGGSRVVKLLYKNRLYFRSQVKGETE
RERLLLASQTSGEIVLGRFPVNKELALEMAALMAQVEYGDLERPNPPGPGGTPPTKAQHH
VQQVLDRFYPRRYRHGAPIEQLRLLTDLLTTKWAALQGCSPPECVRIFLTVARKWTFFGA
KLFAAQTAQLSSKNILVWIAVNEDGVSILDHNTMQVHVTYPYSSVMTFGGCRDDFMLVIR
SVPDQNSGKGHIEKLIFRMAAPKIAEATFVMASYMNHCSAAVNKPSHPPAAHQLWELDGR
QFFAPIPSAANRPALL
Download sequence
Identical sequences ENSEEUP00000011529 ENSEEUP00000011529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]