SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011715 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011715
Domain Number 1 Region: 99-216
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000151
Family Second domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000121
Family First domain of FERM 0.0073
Further Details:      
 
Domain Number 3 Region: 288-363
Classification Level Classification E-value
Superfamily PH domain-like 0.000000218
Family Third domain of FERM 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011715   Gene: ENSEEUG00000012809   Transcript: ENSEEUT00000012861
Sequence length 997
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5204:15318:353463:-1 gene:ENSEEUG00000012809 transcript:ENSEEUT00000012861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQLVPDSALSLLMMTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEY
FGIAFTDETXXXXXXXXXXXXXXXXXXXXXXXXVLYFCVRFYIESISYLKDNATIELFFL
NAKSCIYKELIDVDSEVVFELASYILQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVTRRTFGHSGIAVHTWYAC
PALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGK
IISGSSGSLLSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELT
GKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAAR
RLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIAS
EDSSLSDALVLEDEDSQVTSTLSPLQSPHKGLPPRPPSHHRPPPPQSLEGLRQTHYHRSD
YDKSPIKPKMWSESSLDEPYEKVKKRSSHGHSSGHKRFPSTGSCGSLQSSPVRSLPHWSP
QSSMPSTPDLRLRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSENDTGS
PDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNAHYSTLAEDSPSKARARQRQRH
AGALGGANSGSMPNLAARGGAHGVYLHSQSQPSSQYRIREYPLYVESGATPVVVRSLESD
QEGHYSVKAQFKTSTSYTAGGLFREGWRGCEDDSGRLGPSRSQILRTPSLXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXALPQSQRSSTPSSEIGTTPPSSPHHILTWQT
Download sequence
Identical sequences ENSEEUP00000011715 ENSEEUP00000011715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]