SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011774 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011774
Domain Number 1 Region: 275-419
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-35
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000447
Further Details:      
 
Domain Number 2 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-34
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 3 Region: 422-534
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 4 Region: 674-785
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-17
Family MAM domain 0.0038
Further Details:      
 
Domain Number 5 Region: 84-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000471
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011774   Gene: ENSEEUG00000012888   Transcript: ENSEEUT00000012925
Sequence length 922
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2764:500:206110:1 gene:ENSEEUG00000012888 transcript:ENSEEUT00000012925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFALTWVFLALCFSGHGVRGQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYDFIEIRDGDSEAADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHEEPLENFQCNLPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSSKEYLQVDLRFTLLTAATKSFRTQCYYVYRVSTIED
WMVYRHGKNHKIFQGNSDATEVVQNKLHMPLLTRFVRVRPQTWHSGIALRLELSGCRVTD
APCSNMLGMLSGLIPDSQISASSTREYLWSPSAARLVSSRSGWFPRTPQAQPGEEWLQVD
LGAPKSVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQAKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKPTVETLGPTVKSE
ETTTPYPIDEEATECGDNCSFEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDRNFLRLQSDGQREGQYARLISPPVHLPRNAVCMEFQYQATGGRGVALQ
VVREASQESKLLWMIREDQGSEWKHGRIILPSYDMEYHVRIVFEGVIGNGRSGEIAIDDI
RISTDVPLENCMEPISAFAGENFKVDIPELHGREGYEDEIDDEYEVDWSNSSTPTSGSGA
PSTDKEKNWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYN
FELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences ENSEEUP00000011774 ENSEEUP00000011774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]