SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011782 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011782
Domain Number 1 Region: 255-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-39
Family SPRY domain 0.0000909
Further Details:      
 
Domain Number 2 Region: 56-114
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 7-50
Classification Level Classification E-value
Superfamily RING/U-box 0.000000389
Family RING finger domain, C3HC4 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011782   Gene: ENSEEUG00000012928   Transcript: ENSEEUT00000012933
Sequence length 416
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8918:25487:39117:-1 gene:ENSEEUG00000012928 transcript:ENSEEUT00000012933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CITAKNELLTDLVGKSSCPVCRTSYQPGDLRPNRHLANIAGRLREVKWSLKEEQKTAPLC
ARHGEKLLLFCKEDWKVICWLCERSQEHHGHKTFLLEEVVKECQEKFQKTLQRLGKKQQE
IESLEIDIRRQGTQWKVGRAKEMQSVQAEYKQLRDVLDSEEQMELQMLKTQEGDILSKMT
EAEHELAQQRQLVTALISNLDHQLLGSAVEMLQLIFVIHRSETLILKKLTRFSMPERSVH
QAPGLRRTIQALNELKDVQQYWVDITLEPDKSAAVVSSDGRQVSYCEDYGVLGSRIITSG
KHYWEVDVSHKRAWILGIYDYQPKYGYQVIGLQNTSEYVAFRFFGDAETVTLSTTVPPRR
VGIFLDGEADTLSFYNVTNQGCLIYKFSSCSFSQEVRPYLNPMTCEFPMTVCPSSG
Download sequence
Identical sequences ENSEEUP00000011782 ENSEEUP00000011782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]