SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011897 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011897
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.83e-49
Family Mitochondrial carrier 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011897   Gene: ENSEEUG00000013051   Transcript: ENSEEUT00000013056
Sequence length 209
Comment pep:novel scaffold:HEDGEHOG:scaffold_243196:3560:4858:-1 gene:ENSEEUG00000013051 transcript:ENSEEUT00000013056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMTVPATAIYFTAYDQLKAFLCARALTSDLYAPMMAGVLARLGTVTVVSPLELVRTKLQA
QHVSYRELGTCVRAAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKTWLSGHRPMD
QTSVGVSFVAGGISGTVAAILTLPFDVVKTQRQVALGAMEAVRVKSPRADSTWLLLRRIQ
AESGTRGLFAGFSPGIIKAAPSCAFMISN
Download sequence
Identical sequences ENSEEUP00000011897 ENSEEUP00000011897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]