SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011908 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011908
Domain Number 1 Region: 727-925
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-47
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 1482-1543
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-17
Family SH3-domain 0.0000374
Further Details:      
 
Domain Number 3 Region: 194-259
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 93-155
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 5 Region: 17-80
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000302
Family SH3-domain 0.0039
Further Details:      
 
Domain Number 6 Region: 988-1029
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000115
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011908   Gene: ENSEEUG00000013022   Transcript: ENSEEUT00000013067
Sequence length 1546
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_257:2400:51728:-1 gene:ENSEEUG00000013022 transcript:ENSEEUT00000013067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFPSSFVEIVTIPSLKEGERLFVCISEFTSQELNSLPLHRGDLVILDGSPTAAWLRGRSC
WGARGFFPSSCVNELCLSSQSQQWHSQSTQLQIPDYSMGQARALMGLSAQLDEELDFREG
DVITIIGVPEPGWFEGELEGRRGIFPEGFVELLGPLRTVDEPVNTGNHDDRVINITVDTP
PTEEKGPEEDEEQPGTYGIALYRFQALEPNELDFEVGDKIQILGTLEDGWLEGSLKGRTG
IFPYRFVKLCSKTRVEGTMDLSPESSLTRIPETSLDCSDNSLEVEEKICESPDCKTESSN
GSTSETIISPLEHLTPEYEANRNFPQDESTSGGSPRSPGIRHEQPLASVCSTKDPSEVNG
VSSQSQASFHPKLQEKQYYSTTGESHPHPQQYSDPVPREARTRDYSSLPLRGLYSQPRTL
QKPRPPPHSDSFLSSPRVGRHSQWSPQLQGMAKCAKKYHTLEENISSFFFPSERSELKPR
SQDRVPRVEAMTLPQGDGTVDLDSKLTQQLIEFEKSLSGPGTEPDKILRHFSIMDFNSEK
DIVRGSSKALTQQELPGRRKALRPPPPRPSTVPSTSPQLLVDQNLKPELPLAVRPSRPAP
LPPSAQQRMNAAPPRPPVSHHPTCETLEKEGSEQGEKTLDPTSQCPLVLVRIQEMEQDLD
MYNRTQEELSLLLESQEESLKAETLETLEFYDSNMGSLNMDLQQLREMTLLSSQSASPVA
SSGSVSTENPEQRMLEKRSKVIEELLQTERDYIRDLEMCIERIMTPLQQAQVPNVDFEGL
FGNMQMVIKVSKQLLADLEVSDAVGPIFLGHRDELEGTYKVYCQNHDEAISLLEVYEKDE
RIQKHLQDSLADLKSLYSEWGCTNYINLGSFLIKPVQRVMRYPLLLIELLNSTPESHPDK
VPLTNAVLAVKDINVNINEYKRRKDLGKKSIPDKKSLSARKRAFLTYSLVLKYRKGDEDS
LMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDL
SLYLQHIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLKVAGREGNLIAIFHEE
HSRVLQQLQVFTFFPESLPATKRSFERKTIDRQSTRKPLLGMXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKGFVYSSFLR
PYNARRSHSDASVGSHSSHESEHNSASPRFPRQNSSSTLTVNPSSMAVTFTSGPCQKQPL
EDSPLEGQGLLTTSLTQSSGSSSSKTLDPDTTAQPWDFAXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYFAVYTFKARNPNE
LSVSANQKLKILEFKDVMGNTEWWLAEVNGKEGYVPSNYIRKAEYT
Download sequence
Identical sequences ENSEEUP00000011908 ENSEEUP00000011908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]