SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011926 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011926
Domain Number 1 Region: 1095-1231,1317-1454
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.53e-56
Family Myotubularin-like phosphatases 0.0002
Further Details:      
 
Domain Number 2 Region: 865-999
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000111
Family GRAM domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011926   Gene: ENSEEUG00000012998   Transcript: ENSEEUT00000013085
Sequence length 1659
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1331:1901:15035:-1 gene:ENSEEUG00000012998 transcript:ENSEEUT00000013085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPERNPPTFFVAVLTDINSERHYC
ACLTFWEPADPTQEAACNEDLTDREEEEEGGPLRQSQSPTVPGPPGQLFAPKTLVLVSRL
DHAEVFRNSLGLIYTIHVEGLNVGLENVIGNLLTCTIPLAGGSQRTISLGAGDRQVIQIP
LADSLPISRCSVALLFRQLGITNVLSLFCAALTEHKVLFLSRSYQRLSDACRGLLALLFP
LRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQELLDVIIADLDGGTVTIPECVH
IPPLPEPLQSQTHSLLSMVLDPELELADLAFPPPSTSTSSLKMQDKELRAVFLRLFAQLL
QGYRWCLHMVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVLEGMAFACFVSERGVTLHKI
DLCDELVAHDVARMRADENHPQRVLRHVKELAEQLYKNENPYPAVAMHKVQKPGEASHLR
RAPRPFPRLDEGTVQWIVDQATAKLQGAPPAVKAEKKTTVPSGPPMTAILERSSGLHGNS
ARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARRCLAQELHLHVQQNRAVLDHQ
QFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRKLSPGVTQFAYSCVQEHVVWSTP
QFWEAMFYGDVQTHIRALYLEPAEDQDPSQGGEVSAQNESSALDVASEQRRLWPTLSREK
QQELVQKEESTVFSQAIHYANRMSYLLLPLDSSKSRLLRDRAGLGDLESASNSLVTNSMA
GSVAESYDTESGFEDAESCDVAGAVVRFINRFVDKVCTESGVTSDHLKGLHVMVPDIVQM
HIETLEAVHRESKRLPPIQKPKLLRPRLLPGEECVLDGLRVYLLPDGREEGTGGSGGGPA
LLPAEGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFPVAALTKEKRINVQTPVQLLQDGLQ
LRSCTFQLLKMAFDEEVGSDSAELFRKQLHKLRYPPDVRGTFALTLGSMHTPGRPPRVAK
DKGPSLRTLSRNLVKNAKKTIGRQYVTRKKYNPPSWEHRGQPPLEDQEDEISVSEELEPS
TLTPSSALKPSDRMTMSSLVERACCRDYQRLGLGTLSSSLSRAKSEPFRISPVNRMYAIC
RSYPGLLIVPQSIQDNALQRVSRCYRQNRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFK
AQNAPSPGQSQADSSSLEQEKYLQAVVSSMPRYADASGRNTLSGFSSAHMSSHVPSPRAR
VTTLSNPMAASASRRTAPRGKWGSVRASGRSSGLSTDVGSRLAGRDMLAPPQANGALPDP
GFLRPQRAALYIIGDKAQLKGVRPDPLQQWELVPIEVFEVRQVKASFKKLLKACVPGCVP
AELSPTSFLRSLEESEWLVQIHKLLQVSVLVVELLDSGSSVLVSLEDGWDITTQVVSLVQ
LLSDPFYRTLEGFRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETLAEGPPYDWELAQGPPE
PPEEDRPDGGAPQSRRRVVWPCYDSRPRAQPDAISRLLE
Download sequence
Identical sequences ENSEEUP00000011926 ENSEEUP00000011926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]