SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011930 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011930
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.2e-24
Family Pointed domain 0.0000837
Further Details:      
 
Domain Number 2 Region: 333-387
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.33e-18
Family ets domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011930   Gene: ENSEEUG00000013089   Transcript: ENSEEUT00000013089
Sequence length 400
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4316:789:70382:1 gene:ENSEEUG00000013089 transcript:ENSEEUT00000013089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPVYWSRDDVAQWLKWAESEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYD
FLQHILKQRNPRILFSPFFHPGNSIHTQPEVMLHQNHEEXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMIRRSPAERAPGPRLHQDNNHQEPYPLS
VSPMENNHCPPPPTDPHPKPSSPPRQESTRVIQLMPSPIMHPLILNPRHSVEFKQSRLSA
TEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRTNMTYEKMSRALRHYYKLNIIRKEPG
QRLLFRFMKTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
Download sequence
Identical sequences ENSEEUP00000011930 ENSEEUP00000011930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]