SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000011958 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000011958
Domain Number 1 Region: 291-611
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.83e-109
Family Mammalian PLC 0.0000000908
Further Details:      
 
Domain Number 2 Region: 629-755
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.91e-29
Family PLC-like (P variant) 0.0000948
Further Details:      
 
Domain Number 3 Region: 13-123
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-25
Family Pleckstrin-homology domain (PH domain) 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000011958
Domain Number - Region: 260-290
Classification Level Classification E-value
Superfamily EF-hand 0.0122
Family EF-hand modules in multidomain proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000011958   Gene: ENSEEUG00000013083   Transcript: ENSEEUT00000013120
Sequence length 764
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2561:10764:34149:1 gene:ENSEEUG00000013083 transcript:ENSEEUT00000013120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLQGRLPASEDLLLMQNGTMMRKVRSRSWKKLRYFRLQEDGMTVWHARTVGGSAKPS
FSISDVETVREGHESELLRSLAEEFPLEQGFTVVFHGRRSNLDLVAGSVAEAQVWMAGLQ
LLVDAVTNMDQQERLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXKLRHVLSMDGLLSYLSSKDGDIFNPACLPVYQDMTQPLNHY
YISSSHNTYLLGDQFCGXXXXXXXXXALKRGCRCLEVDIWDGPNGEPIVYHGHTLTSRIL
FKDVVASVAQYAFQTSDYPVILSLENHCSWDQQQTLASHLTEILGDQLLSTTVDGLLPTQ
LPSPEELRRKILVKGKKLQTLEEDLEEEEEEEELELQLEREGEPELEPEVQSEPEGPELS
PRSQDKRKRPKSVLCPSLSALVVYLKSVSFHSFAHSRDHYRFYEISSFSEAKAKSLIKEA
GKFQHIALLSRVYASGLRTVSKYNPQELWNAGCQMVAMNVQTAGLEMDICDGLFRQNGGC
GYVLKPGFLRDAQSTFYPERPVGPSKAQILRIQVISGQQLPKGAKTKEGTTLVDPLVRVE
VFGVRPDTARQETNHVENNGFNPYWGETLCFRVQVPELALLRFLVKDYNWKFRDDFVGQY
TLPWTCMQQGYRHIHLLSKDGISLHPASIFVHICIEEEPEEAEF
Download sequence
Identical sequences ENSEEUP00000011958 ENSEEUP00000011958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]