SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012000 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012000
Domain Number 1 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-40
Family Second domain of FERM 0.000000456
Further Details:      
 
Domain Number 2 Region: 31-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-40
Family First domain of FERM 0.00000219
Further Details:      
 
Domain Number 3 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-37
Family Third domain of FERM 0.00000115
Further Details:      
 
Domain Number 4 Region: 409-544
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.27e-31
Family Protein kinases, catalytic subunit 0.000000521
Further Details:      
 
Domain Number 5 Region: 908-982
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.88e-28
Family FAT domain of focal adhesion kinase 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012000   Gene: ENSEEUG00000013097   Transcript: ENSEEUT00000013164
Sequence length 982
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6806:2886:176881:-1 gene:ENSEEUG00000013097 transcript:ENSEEUT00000013164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAYLDPNLNHTPNSSTKPHLSTGVERSPGAMERVLKVFHYFENSSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMSEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANSEKQGVRTHAVSMSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPDNPVLAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYNLDLASLILYAYQLSTALAYLESK
RFVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXTILEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVSGYPGSHGITAMAGSIYPGQTSLLDQTDSWNHRPQE
ISVWQPNTEDSSALDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDKEDGGLQCPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPVLPASTHRE
Download sequence
Identical sequences ENSEEUP00000012000 ENSEEUP00000012000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]