SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012019 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012019
Domain Number 1 Region: 226-409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-67
Family SPRY domain 0.00000285
Further Details:      
 
Domain Number 2 Region: 30-142
Classification Level Classification E-value
Superfamily Immunoglobulin 4.38e-18
Family V set domains (antibody variable domain-like) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012019   Gene: ENSEEUG00000013185   Transcript: ENSEEUT00000013186
Sequence length 470
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6133:1118:54721:1 gene:ENSEEUG00000013185 transcript:ENSEEUT00000013186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMASSWLLSCLIMLVFLQLMVPMSVHTGDSKSHMAPLGGTAELLCPLSLWPVTVPNQVR
WLRSPHLGHSQAVHVFLNGQDQDDEQMPEYKGRTALVRDSQEGSVTLNIHDVRLEDRGLY
LCQVHIGNLSREGSVTLQVAAPSPGRISSSEVVLAVTLPVLGLLILAGIGLIWKQRRSKE
KLLYEQVMEVENLLSDHAKEKGRLHKALKKLRSELKLKRAAANSGWRRARLHFVAVTLDP
DTAHPKLILSEDRRCVKLGDRRQPVLDNPQRFDFVVSVLGSEYFTGGCHYWEVYVGDKTK
WILGVCSESVSRKGKVTASPANGHWLLRQNRGMEYEALTSPQTIFRLKEAPQCVGIFLDY
EAGVISFYNVTDKSHIFTFIHSFSGPLRPFFEPCLHDGGKNTAPLIICSELQKLESSVVS
KPEKKSCANGDVALKADPSLPFPVIPHTDSILPWSSDLGPALQGLKAPSF
Download sequence
Identical sequences ENSEEUP00000012019 ENSEEUP00000012019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]