SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012120 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000012120
Domain Number - Region: 18-68
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0113
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012120   Gene: ENSEEUG00000013298   Transcript: ENSEEUT00000013300
Sequence length 123
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_210108:1308:3490:1 gene:ENSEEUG00000013298 transcript:ENSEEUT00000013300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAIAIPLAAGLL
LLLFVGKSSLSPVGCGKLLPQNMLSHFGFSWGSLPPAHPRELPVELPISYLLSSLCLRLI
ELK
Download sequence
Identical sequences ENSEEUP00000012120 ENSEEUP00000012120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]