SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012154 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012154
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.79e-59
Family BAR domain 0.0026
Further Details:      
 
Domain Number 2 Region: 260-364
Classification Level Classification E-value
Superfamily PH domain-like 3.78e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 3 Region: 413-466
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.11e-24
Family Pyk2-associated protein beta ARF-GAP domain 0.00082
Further Details:      
 
Domain Number 4 Region: 648-686
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000556
Family Ankyrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012154   Gene: ENSEEUG00000013296   Transcript: ENSEEUT00000013336
Sequence length 777
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6361:180685:280316:-1 gene:ENSEEUG00000013296 transcript:ENSEEUT00000013336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTVDFEECLRDSPRFXXXXXXXXXXXXXXXXXXXXLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSKDAVIETSLXXXXXXXXXXXXXXXILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHLALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPFMKDLGAQXXXXXXXXXXXXXXXXX
XXXXXXXXDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKSNDSGIQQSSDDGRESLPSTVSANSLYEPXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLIQVLGGSLVTCEFLL
QNGANVNQRDVQGRGPLHHATVLGHTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences ENSEEUP00000012154 ENSEEUP00000012154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]