SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012435 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012435
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-52
Family Necap1 N-terminal domain-like 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012435   Gene: ENSEEUG00000013627   Transcript: ENSEEUT00000013638
Sequence length 276
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5592:513:15173:1 gene:ENSEEUG00000013627 transcript:ENSEEUT00000013638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESGYESVLCVKPEVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITSQGQAAYIKLE
DRTSGELFAQAPVEQFPGAAVESVADSSRFFVIRVQDGSGRRAFIGIGFADRGDAFDFNV
ALQNHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMKKKEGEAGNPRGRPA
STGRLKLLLPPPRGRSYSCFLPPWGQLSGGGPLVQPAAAPSPGHLPARLPPRLSQARAGS
SSDPRTPFSHKTLGKQLPRLGPRKKDEALCQPLFGA
Download sequence
Identical sequences ENSEEUP00000012435 ENSEEUP00000012435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]