SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012567 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012567
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 1.02e-19
Family Calbindin D9K 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012567   Gene: ENSEEUG00000013803   Transcript: ENSEEUT00000013784
Sequence length 79
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_368:84729:88685:1 gene:ENSEEUG00000013803 transcript:ENSEEUT00000013784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAKKSPAELKSIFEKYAAKEGDPDQLSKEELKLLIQTEFPNLLKGPSTLDDLFQELDKN
GDGEVSFEEFQVLVKKICQ
Download sequence
Identical sequences A0A1S3AQL7
XP_007539053.1.11023 ENSEEUP00000012567 ENSEEUP00000012567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]