SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012591 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012591
Domain Number 1 Region: 323-559
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.27e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 142-252
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000771
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 34-154
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000214
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012591   Gene: ENSEEUG00000013786   Transcript: ENSEEUT00000013808
Sequence length 966
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4329:325:70525:1 gene:ENSEEUG00000013786 transcript:ENSEEUT00000013808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLVGDFSVSPAVPEGQLTGVSPTLPSVGPANKHKPWIEAEYQGIVMENDNTVLLNPPLF
ALDKDAPLHYAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQA
YDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDG
DCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYRFTVTAYDCGKKRAADD
AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHV
AKGCDRDNYSERALRKLCGAAPGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQA
VQVPVGGTAGLGSGSQDNLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYS
LTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGISFDPA
LIHDNGLIHPPRREPALMIGACWTEEKNKEKEKGADNSTDPSQGDPLLIHHYFHGYLAGF
SVRSGRLESREVIKCLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHAL
QHVAYMNTLRFATPGVRPLRLTTAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVESITVYEDLLRQARYHLRQG
AALYARKFRLSCSEMNGRYSSNEFIVEVSVLHSVNQVAHPSHVLNSQQFLHHGHQPPPEM
AGHSLASSHRNSMVPSAATLIIVVCVGFLVLMVILGLVRIHSLHRRVSGTSGPPGASSDS
KDPDLFWDDSALTIIVNPMESYQSRQTCVAGAPGVQQEDEDSSDSEAADSPSSDERRIIE
TPPHRY
Download sequence
Identical sequences ENSEEUP00000012591 ENSEEUP00000012591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]