SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012701 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012701
Domain Number 1 Region: 216-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000173
Family Galectin (animal S-lectin) 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012701
Domain Number - Region: 130-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0216
Family Galectin (animal S-lectin) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012701   Gene: ENSEEUG00000013917   Transcript: ENSEEUT00000013928
Sequence length 267
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3592:61517:69124:1 gene:ENSEEUG00000013917 transcript:ENSEEUT00000013928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFSCNCSFLSFQLNDAGCGNPNPQGWPSPWGYQPTRTGAYPGQALLEATHPGAYPGQAP
PEAYPGQAPPGAYPGPTAPAYPGAYPGQPSSGSGVYPGLPSSPGVYPPPGQPSAPGAYPG
AGPVGTPAGPLIVPYELPLPGGIKPRMMFTILGTVKPNATXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQVLVEKDHYKVAANDCHLLKYNH
RISNLSEINKLGIYGDIDLTSASYAVI
Download sequence
Identical sequences ENSEEUP00000012701 ENSEEUP00000012701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]