SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012704 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012704
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily PX domain 0.00000258
Family PX domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012704
Domain Number - Region: 308-399
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000105
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012704   Gene: ENSEEUG00000013911   Transcript: ENSEEUT00000013932
Sequence length 405
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3434:5267:79347:-1 gene:ENSEEUG00000013911 transcript:ENSEEUT00000013932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLDDGPDFLSDEDRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XEFSVVRQHDEFIWLPDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEE
FTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKX
XXXXXXXXXXXXXXXXXXXXXXXDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKXX
XXXXXXXXXXLYALGTQDSTDICKFFLKVSELFDKTRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQE
LIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLVVLNGDT
Download sequence
Identical sequences ENSEEUP00000012704 ENSEEUP00000012704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]