SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012715 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012715
Domain Number 1 Region: 9-84
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-25
Family Phosphotyrosine-binding domain (PTB) 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012715   Gene: ENSEEUG00000013953   Transcript: ENSEEUT00000013945
Sequence length 507
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6460:6044:16573:1 gene:ENSEEUG00000013953 transcript:ENSEEUT00000013945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLEVPRTPRTPTTPGFVAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKSRTSVHVPLEARISNAESNTPKEEPSSIEDRDA
QILLEPKGVKFVLGPTPVQKQLVAKEKLEQLGKDPVSGSGANNTEWDTGYDSDEWRDAPS
VTKLVYKNINGLSISSASGVRRGRLTSTSTSDTQNINNSARRTALLNYENLPSLPPVWEA
HKLSKDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRWDCTPTVFN
FDIRCPSLEHRQLNYIQVDLEVGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAA
MSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences ENSEEUP00000012715 ENSEEUP00000012715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]