SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012731 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012731
Domain Number 1 Region: 560-740
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.45e-51
Family Oxysterol-binding protein 0.00029
Further Details:      
 
Domain Number 2 Region: 92-168
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000115
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012731   Gene: ENSEEUG00000013946   Transcript: ENSEEUT00000013962
Sequence length 754
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4777:1451:38741:-1 gene:ENSEEUG00000013946 transcript:ENSEEUT00000013962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGAEPVSTMKVSESEGKLEGLVTAVTPNKNSSNSSCGGGISGSASGSGSSRGGCAKGWQ
YXXXXXXXXXXXXXXXXXXXXXXXXVFCFNNEAGLLEYFVNEQSRNQKPRGTLQLAGAVI
SPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTI
EWLEPKISLSNHYKNEADQPFASEQSKPVAVPEAQCVTESGLLAREPEDINADDEVEDTC
DNKEDDLGAVEEQRSIILHLLSQLKLGMDLTRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXILSLLEHGEEYTFSLPSAYARSILTVPWVELGGKVSVNCAK
TGYSASITFHTKPFYGGKLHRVTGEVKHNTSNSVVCRVQGEWNSVLEFTYSNGETKYVDL
TKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKRTLEERQRTEERHRTE
KGTPWKTKYFIKEGDGSVYHKPLREIFPTSTPAE
Download sequence
Identical sequences ENSEEUP00000012731 ENSEEUP00000012731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]