SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012815 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012815
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000334
Family Ovomucoid domain III-like 0.00018
Further Details:      
 
Domain Number 2 Region: 232-287
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000851
Family Ovomucoid domain III-like 0.0071
Further Details:      
 
Domain Number 3 Region: 162-210
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000707
Family Ovomucoid domain III-like 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012815
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000824
Family TB module/8-cys domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012815   Gene: ENSEEUG00000014055   Transcript: ENSEEUT00000014050
Sequence length 315
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_305006:10877:13858:1 gene:ENSEEUG00000014055 transcript:ENSEEUT00000014050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCI
PCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGMDGKTYRNECALLKAR
CKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGN
DGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSL
CDELCPETKSEEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEED
EDQDYSFPISSILEW
Download sequence
Identical sequences ENSEEUP00000012815 ENSEEUP00000012815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]