SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012940 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012940
Domain Number 1 Region: 461-632
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-47
Family SPRY domain 0.00082
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-18
Family RING finger domain, C3HC4 0.0077
Further Details:      
 
Domain Number 3 Region: 147-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000214
Family B-box zinc-binding domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012940   Gene: ENSEEUG00000014194   Transcript: ENSEEUT00000014184
Sequence length 635
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2953:700:57873:-1 gene:ENSEEUG00000014194 transcript:ENSEEUT00000014184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELFPLAEELSCSICLEPFKMPVTTPCGHNFCGLCLEETWSVQGAPYRCPQCRAVYQAR
PQLHKNTVLCAVVEQFLQAEMAQEALPDGWTPPERATAPSRAGHVACDHCLKVAAVKTCV
VCMASFCLEHLLPHRESPAFRDHQLQEPIFDLMRRKCPQHNRLREFFCPEHDECICHVCL
VEHKTCSPVSLTDASRDLEAKLKHKLTIVYSQVNGATKALEDVRVKQQNIREATQRKMEL
LRQEYKEMKALIDASEANATRKIKEEEKRVSSKFDTIYQILLKKKSEIQAAKEEMEFALT
KGGDEFEFLEKAAKLYRITTKSVYIPKVELNHELIRGVCQGSSDLKNELKRSVQQFQDKK
SEAAPGTGESGELGAVFLGKPGPQKKVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVRVILDYNTAHNKVALSENY
SVASVADPPLHYRPHPQRFVYCSQVLGLNCYKKGIHYWEVELQKNNFCGVGVCYGSMDRQ
GLESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATKVGVLLNCDHGFVIFFAVVES
KIHLMYKFKVDFTEALYPAFWVFSAGATLSLCNPN
Download sequence
Identical sequences ENSEEUP00000012940 ENSEEUP00000012940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]