SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012956 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012956
Domain Number 1 Region: 254-416
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000523
Family BAR domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012956
Domain Number - Region: 178-209
Classification Level Classification E-value
Superfamily PX domain 0.00638
Family PX domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012956   Gene: ENSEEUG00000014208   Transcript: ENSEEUT00000014200
Sequence length 418
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5007:42400:153742:1 gene:ENSEEUG00000014208 transcript:ENSEEUT00000014200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPPKALQSTGPHSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMTRSFGDKDLILPNGG
TPADTSSPASSSSLLNRLQLDDDIDGETRDLFVTVDDPKKHVCTMETYITYRITTKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAL
DKFLKRITDHPVLSFNEHLSVFLTAKDLNVYKKQGMALLTRVGESVKHVTGGYKLRSRPL
EFAAIGEYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELTEPLEG
VSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAEYEAKLEAVAL
RKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEK
Download sequence
Identical sequences ENSEEUP00000012956 ENSEEUP00000012956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]