SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012962 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012962
Domain Number 1 Region: 191-295
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.28e-37
Family ets domain 0.0000928
Further Details:      
 
Domain Number 2 Region: 7-116
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.94e-24
Family Pointed domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012962   Gene: ENSEEUG00000014215   Transcript: ENSEEUT00000014206
Sequence length 300
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_376338:30098:52850:-1 gene:ENSEEUG00000014215 transcript:ENSEEUT00000014206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEGSGVMNLNPSNNLLHQQSAWADSYPTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQ
HLLDTNQLDANCIPFQEFDISGDHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCGSD
LFQSTHNVIVKTEQTDHSIMNTWKEENYLYDTNYGNTVDLLDSKTFCRAQISMTTAGHVP
VAESPDMKKEQDHPTKSHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGIFRFL
KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Download sequence
Identical sequences A0A1S2ZN07
ENSEEUP00000012962 ENSEEUP00000012962 XP_007521879.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]