SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000012974 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000012974
Domain Number 1 Region: 1245-1388
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.42e-20
Family Pentraxin (pentaxin) 0.01
Further Details:      
 
Domain Number 2 Region: 1669-1738
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 3 Region: 1609-1680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-17
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 4 Region: 2570-2638
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1785-1853
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.17e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1727-1794
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000109
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 6-81
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000181
Family Integrin A (or I) domain 0.0058
Further Details:      
 
Domain Number 8 Region: 2466-2522
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000526
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 2378-2444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000526
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 10 Region: 1506-1568
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.00059
Further Details:      
 
Domain Number 11 Region: 2513-2574
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 12 Region: 3212-3271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000783
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 255-318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 14 Region: 1968-2021
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 1452-1517
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 16 Region: 199-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 17 Region: 3094-3150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 1906-1979
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000903
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 19 Region: 1842-1910
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 20 Region: 2336-2383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000001
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 21 Region: 1016-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 22 Region: 2622-2676
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000236
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 23 Region: 1052-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 24 Region: 2973-3026
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000306
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 25 Region: 872-967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000628
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 26 Region: 1567-1606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000295
Family EGF-type module 0.072
Further Details:      
 
Domain Number 27 Region: 2944-2984
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000032
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number 28 Region: 100-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000361
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000012974
Domain Number - Region: 550-603
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000104
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number - Region: 3263-3300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000164
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 3302-3329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000893
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 3331-3361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000012974   Gene: ENSEEUG00000014095   Transcript: ENSEEUT00000014218
Sequence length 3367
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6324:2173:161946:-1 gene:ENSEEUG00000014095 transcript:ENSEEUT00000014218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QILAHSRENATKVVFLITDGYSNGGDPRPVAASLRDWGVEIFTFGIWQGNIRELNDMASS
PKEEHCFLLHSFEEFEALARRSLHEDLPSGSFIQEDMSHCSYLCEAGRDCCDGMASCKCG
THTGQFECVCEKGHYGRGLQQECTACPAGTYKPEGSPGGVSTCLPCPDVNHTSPPGSTSP
EDCVCREGYRASSQSCEVVRCPALKPPEHGHFIQNTCNNHFNAACGVRCDPGFDLVGSSI
LLCLPSGLWSGSESLCRVRTCPRLRQPRHGHLSCSTGEMSYKTVCLVSCDEGYRLEGRAK
LTCQINSQWDGLEPRCVERHCSTFQKPRGVIVSPPSCGKQPAKPGLICQLSCRQGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVEAPQISCPKDIEVKTQEQQDSANVTWQIPTAKDNS
GDKVLLHVHPAFTPPYLFPIGDVAITYTAVDQSGNQASCTFHIKVLDVEAPSVDWCRSPP
PVQVSEKEYAASWEEPQFSDNSGALLAVTRSHTPGDLFPHGETVVSYTATDPSGNNRTCD
IHILIRGSPCEAPFTPANGDLVCTQDSIGVNCTFSCQEGYDLPEGSTENYHCAYEDGVWK
PPYSTEWPDCACKRFANHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPSFCSDA
DDIDCRLEDLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDVVRETATGHTKA
RPLRNRRSAPLSDHKIKLVFNITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCPLGTSYSQEHHVCESC
AVGFYQDEEGQLECKFCPADTRTEYLHSRSISECRAQCKPGTYSSNGLETCESCPLNTYQ
PAHGAQSCLFCPENTSTVKRGAVSISACGVPCPVGEFSRSGLMPCYPCPRDYYQPDAGKS
FCLSCPFYGTTTITGARSITDCSTFGSTFSAAEESIVLRASPGHIKKYEASSKVFHECFL
NPCHNSGTCQQLGRGYVCLCLPGYTGLKCEIDTDECSPQPCHNGGICEDQVGGFTCECPS
GYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQATGFNLDFEVSGIYGYV
MLDGLLPSLHAVTCAFWMKSSDISNYGTPISYAVEDGSDNTFLLTDYNGWVLYVNGKERI
TNCPSVNDGHWHHVAVTWASTDGAWKVYIDGKFSDGGMGLSVGSVIPGICCGGALVLGQE
QDKRGEGFXXXXXXXXXXXXXXXXXXXXXXXXVRLLATACPKELSKGTVLAWPDFLPGVV
GKVKIDSKSTFCSDCPSLEGSVPHLRTSSTDSKPGSKVSLFCDPGFQMVGNPVQHCLNQG
QWTQPLPRCERIRCGVPPPLENGFHSAEDLHAGSTVSYQCSSGYYLLGDSGMFCTDNGSW
NGIPPSCLDECAVGSDCSVHASCLNTNGSYICSCKPPYSGDGKTCAEPVKCRAPGDPENG
RSHSSGESYTVGTLVTFSCEQGHQLLGVTKITCLESGEWDHLVPYCEAVSCGEPAVPENG
HMDAAAFTYGSKVSYRCSKGYALSGDSEASCLASGSWSHSPPVCEAVKCSHPAGISHGKY
TLSGLAYLSTASYSCEPGYRLQGPSVLECSASGNWDRAPPTCHLVFCGEPPAIKDAVLKG
SNFTFGNTVSYTCREGYTLAGADTMECLASGEWSQSGQRCLAVSCDEPPHVQHASPETAH
RLFGDIAFYYCSDGYSLADNPQLVCDAQGRWVPPAGQAVPRCIAQFCESPPSVSYGILES
VSKAKFPTGSVVSFKCMEGFVLNTSSKLECMWGGHWSPAPASIRCIPVRCGQPPSILNGY
ASGANYSFGAMVAYSCNKGFYIKGEKRSTCQATGQWSQPTPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHLHY
GQTVAYTCERGFRLNGSATLTCLDTGDWDGAAPACGAIHCEPPQPIENGFVEGADHSYGA
MIIYSCLPGFQVAGHAMQTCGETGWSGAVPACVPLDCGLPPHVDFGDCRKVGDEPGMEAP
ERAPRLPAPGFLYGATVLYSCHPGYALRGEPVLTCQEDGTWNGSAPACVSAGCGLPEAPD
NGALRLSETAAGSAVRYSCGPGHRLVGAAVRLCLEGGRWSGTPPRCEAAACGRPKAISHG
SVRGGDYSYLSAVDYECQPGYVLHGPRRRTCRESREWDGSEPSCLPVDCGPPPVPAHGRV
KGAEFTFQKAGEHSCEEGFLLGPRSRLCLDGSWSGSPAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCLEGYVIDADTDTFICQADGHWSPQTISCSPKKCLLPASVTHLVHGDDFSVNKQVS
VSCAHGFTYDGVNTSTCQLDGTWEPPFSAGSCXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARCEAPLEFLNGRADIENGTSGPTVVFS
CDRGYSLAGAAEAHCSADGTWSHPAPLCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXISCGPPAHVHNALARGVHYQYGDMITYSCYS
GYTLEGPLRSVCLEMGTWTQPPVCRAVCRFPCQNGGVCQRPNACSCPDGWMGRLCEEPIC
ILPCLNGGHCVAPYQCDCPPGWTGSRCHTAGCQSPCLNGGKCVRPNRCHCLSTWTGHDCS
RKRRSGF
Download sequence
Identical sequences ENSEEUP00000012974 ENSEEUP00000012974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]