SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013090 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013090
Domain Number 1 Region: 17-93
Classification Level Classification E-value
Superfamily EF-hand 0.000059
Family S100 proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013090   Gene: ENSEEUG00000014357   Transcript: ENSEEUT00000014346
Sequence length 103
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1961:39366:60151:1 gene:ENSEEUG00000014357 transcript:ENSEEUT00000014346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPICKQLASIKALGKGSDLEKSMATAALIFRNSSDTDGKLGKTTAKHLLQTQFKNFTEGQ
ETKPKYKNLSDLSKNTDNKLYSDNLIILLLSITVISLQNISIK
Download sequence
Identical sequences ENSEEUP00000013090 ENSEEUP00000013090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]