SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013214 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013214
Domain Number 1 Region: 124-243
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-21
Family Dual specificity phosphatase-like 0.048
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013214
Domain Number - Region: 561-635
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0216
Family BCR-homology GTPase activation domain (BH-domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013214   Gene: ENSEEUG00000014463   Transcript: ENSEEUT00000014482
Sequence length 703
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5644:29480:41170:1 gene:ENSEEUG00000014463 transcript:ENSEEUT00000014482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHMQDTPRRLSAMPFLSAFLQGRRHSTSDPVLRLQQGRRSSAAKMLSSSSLQVMVAVAAV
RGTERSLTCPEKKRISGRPAPKYTKVGERLRHVIPGHMACSMACGKACKYENPARWSEQE
QAIRGVYSSWVTENILAMARPSTELLEKYCIIDQFQTHGIKTVINLQRPGEHASCGNPLE
QESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLG
RTGFWKHVAQRIHPACKLLLDLAENRPVVAGRGPPSVPCPSAEIEKTVSEVVTKQLDKEL
LRHYSDVSCTPSVAADFETPGMPFPHEQEFDPLWKRRNAECVQPLTCLKRQLSYSDSDLK
RAEWLLEQGGTPWTVPAQAMPCQHSEQQMPLSHCHTPQSPRVDLSKEILCRNTFSFWNQT
KCGGLAGLKEDGSPVQQRISKEVQRSRTFSSGVYNPGEPASPNFANLHKEQDCSDHQALP
DQGEAHGGGTQGSVSEDGGCDLGTKAQFSIVPETDDSKDVSQVTPHTVLLSELSVEARRV
LVAKALANLNEFAEEEEMKRKVEMWQKELNSQDGAWERICGERDPFTLCSLMWSWVEQLK
EPVITREDVDMLVDSHSDTAEALFLLEKGQHQTILCVLHCIVSLQTLPANLEEAVLVHTI
KAFTKVNFDSENGPIVYNTLKKIFKHTLKEKRKMAQDGPQPGV
Download sequence
Identical sequences ENSEEUP00000013214 ENSEEUP00000013214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]