SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013215 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013215
Domain Number 1 Region: 493-544
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000402
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 99-184
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000017
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 
Domain Number 3 Region: 424-476,576-638
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000249
Family LacY-like proton/sugar symporter 0.061
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013215
Domain Number - Region: 261-328
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00615
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013215   Gene: ENSEEUG00000014465   Transcript: ENSEEUT00000014484
Sequence length 668
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7221:14836:50299:-1 gene:ENSEEUG00000014465 transcript:ENSEEUT00000014484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRREGIENPAFVPSTPDTPHRSSASPSYVQVSVSSINDKEDNSGPQEPPELPKAREPPL
PSATPPGSPEPRPELLSFQEGPCGWGNFNLCLQRCTPKYLFYYCLLALTQGVAVNGLVNI
SISTIEKRYEMKSSLTGLISSSYDIAFCVLSLFVSFIGERGHKPRWLSFASFMIGLGALV
FSLPKFFTGRYQLGSLYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXIGYSMSILGPAVGYLLGGQLLTLYIDLGMGKRVSITEEDP
RWLGAWWIGFLLVWLFAWSLIIPFSCFPKHLPGTAKIQDEKTSQAHQNKNCSLQHIDNNF
GKSFKDFPAALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XAVLIPGAALGQILGGVLISKFKMTCRNTMKFALLTSVFSLALSFVFIYANCENEPFAGV
HETYNGTGELGNLTAPCNADCNCLQSNYYPVCGGNGVQYFSPCYAGCKNSILENQSKVYY
NCSCIERKTELTPTEAGFNFEAKAGKCGTQCQYMPVFLGVFFFTIIFTFMSGTPITVSIL
RCVNQRQRSLALGMQFMLLRVLGTIPGPIIFGVMIDSSCVLWDVNECGVKGACWVYDNIK
MAHMLVAI
Download sequence
Identical sequences ENSEEUP00000013215 ENSEEUP00000013215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]