SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013274 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000013274
Domain Number - Region: 12-52
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0051
Family SAM (sterile alpha motif) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013274   Gene: ENSEEUG00000014541   Transcript: ENSEEUT00000014548
Sequence length 479
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4241:11780:36171:1 gene:ENSEEUG00000014541 transcript:ENSEEUT00000014548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGAPAWLGMAPREPPPKPPK
CGSASCAQSPGLGSLGGSGSRAGAGAGEARLWPGLQSGSEHSLSPADPDPGSPASSPRDS
GEALDAAAALSVAECVERMAATLPRGGAGEARELLRANKKLARMVGHIFDMDDGDPHKEE
EIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAGQLCVKNALLTRRDELFALARQISREV
TYKYTYRTTXXXXXXXXXXXXXXXXXXDGFPDFQDSVQTLFQQAKAKSEELAALSSQQPE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGILKDYPHSAFTLEKKVIKTEPEDSR
Download sequence
Identical sequences ENSEEUP00000013274 ENSEEUP00000013274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]