SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013321 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013321
Domain Number 1 Region: 419-567
Classification Level Classification E-value
Superfamily GFP-like 1.78e-58
Family Domain G2 of nidogen-1 0.000000114
Further Details:      
 
Domain Number 2 Region: 916-951,1006-1165
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-35
Family YWTD domain 0.0000000521
Further Details:      
 
Domain Number 3 Region: 797-905
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-25
Family Thyroglobulin type-1 domain 0.00061
Further Details:      
 
Domain Number 4 Region: 375-416,699-738,774-827
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000879
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013321
Domain Number - Region: 745-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0479
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013321   Gene: ENSEEUG00000014586   Transcript: ENSEEUT00000014601
Sequence length 1192
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2675:84451:188610:-1 gene:ENSEEUG00000014586 transcript:ENSEEUT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAWTRALLLQLLLAGLGGCLSRGGLFPFGPGAGDLELEAGDDRVSPALELSHGLRFFD
KSGIYSLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNTFQAVLASSD
SASYAIFLYPEDGIQFYTTFSKKEKKQVPAVVAFSQGSVGILWTSNGAFNIFANDKESVG
NLAKSSNSGQQGVWVFEIGSPATASGVVPSDVNPELDDETDYEDEDYDSVTHLGLEDVST
TTFSYEAPKRGDTDTYEVPSVLSPHPLATERPPESPTERTRSFQVPVERFSQQHQQVIDV
DEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYSTGFCCSCVAGYTGNGRQCVAEGS
PQRVNGKVKGRIFVGNSQFPISFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLPLAPI
GGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGKLVVKQKFSGIDEHGHLTIDT
ELEGRVPQISFGSTVHIEPYTELYHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECSEQPSVCGSHAICNNHPGTF
RCECVEGYQFSEAGTCVAVVDQRPIDYCTTGLHDCDIPQRAQCIYTQGSSYMCSCLPGFT
GDGRACQDVDECQSNQCHHDAICYNTPGSFMCQCKPGYQGDGFRCIPGEVEKTRCQLERE
HILGAAGTVDAQRPLPPGLFVPECDKHGHYAPTQCHGSTGYCWCVDRDGRELEGTRTRPG
MRPPCLSTVAPPVHHGPSVPTTIIPLPPGTHLLFAQTGKIEHLPLAGSTMKKMEAKTLLH
TPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGSPEGIALDHLGRN
IFWTDSRLNRIEVAKLDGSQRRVLFDTDLVNPRGIVTDSVRGNLYWTDWNRDSPKIETSY
MDGTNRRILAQDELGLPNGLTFDAYSSQLCWVDAGTHRVECLNPGQSGRRRVLEGLQYPF
AVTSYGKNLYYTDWKTNSVVAVDLAVAKRMDTFHPHKQTRLYGITTALSQCQ
Download sequence
Identical sequences ENSEEUP00000013321 ENSEEUP00000013321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]