SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013329 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013329
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-60
Family FCH domain 0.00078
Further Details:      
 
Domain Number 2 Region: 554-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-44
Family Protein kinases, catalytic subunit 0.0000324
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013329
Domain Number - Region: 513-553
Classification Level Classification E-value
Superfamily SH2 domain 0.00113
Family SH2 domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013329   Gene: ENSEEUG00000014606   Transcript: ENSEEUT00000014609
Sequence length 774
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5199:4771:209500:1 gene:ENSEEUG00000014606 transcript:ENSEEUT00000014609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASSLQNLCNQVDKENTIQ
MNYVSNVSKSWLLMIQQTEQLSRIMKAHAEDLNSGPLHRLTMMIKDKQQVKKSYLSVHQQ
IEAEMIKVTKTELEKLKSSYRQLIKEMNSAKEKYKEALAKGRETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDTTLPLLLDSLQKMQEEMIEALKSIFDEYSQITSLVTEEI
VNVHKEIETSVDQIDPSTEYSNFIDVYRTTAAKDQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLLLSQKQTL
EELKQSVQQLKCTEAKFSAQKELLEQKVQENDGKEPPPVINYEEDARSVTSMERKERLSR
FESIRHSIAGIIRAPKSVLGSSTLCDLMPTFEKPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLYRFEGTGFSSIPQLIDHHYTTKQVITK
KSGVILLNPIPKDKKWVLNHEDVTLGELLGKGNFGEVYKGILKDKTAVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPIYIIMELIPGGDFLSFLRKKKDDIKPKQ
LVKFSLDIASGMTYLESKNCIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLPPLKP
VSHKWPAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVER
Download sequence
Identical sequences ENSEEUP00000013329 ENSEEUP00000013329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]