SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013482 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013482
Domain Number 1 Region: 1122-1283
Classification Level Classification E-value
Superfamily PH domain-like 7.2e-68
Family Pleckstrin-homology domain (PH domain) 0.00000501
Further Details:      
 
Domain Number 2 Region: 921-1121
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-53
Family DBL homology domain (DH-domain) 0.0000000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013482   Gene: ENSEEUG00000014746   Transcript: ENSEEUT00000014775
Sequence length 1498
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4886:976:70275:1 gene:ENSEEUG00000014746 transcript:ENSEEUT00000014775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYTFQGARSHSSVLPGAKPKHCSLKIRSIHAKDNKSLQGWGQGGSLGAPGYKSR
SLARSCFSHFKTNQPYAAASRQPGSACKPPKDSLCCKLKPGASLKGGDFPENGFHYLGHE
PSEPPTALRDCNGHLHPCLGDEDPESPRVRIKTLGKLDGHLRVEFHSGSGPGADGHSSVS
PGDSGGPVQLLRYSPTSEPRSKEGSDFFDSRQDGLNLDLQGPSLGVASSLWSGGYTQLLP
QRSESAQALGGAPLRQMVYENFMRELALSRAHTEPGETSSETAETSSESLSSLEQLDLLF
EKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKHYWVTLKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQQW
GQNLEKFHIDLFRTRCYLASLQGGELPNPKSLLAVASRHSKLALGRLGVLSVSSFHALEC
SREDSALRRRTLSLTQGRSKRSIFSSLKALDTLARRGKEKRPSITQIFDSSGSRGFSGTQ
LPQNSNNSSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKGNEIMTLNGEAVSSLDLKQM
EALFSEKSVCLTLLARPPDTKGTLCSSWSDSSLFSSGQRNLLPPPNQSQLLEEFLDNLKK
NSTNDFSNVPDITTGLKRRQTDGTVDQASHLEKTEQVFRSEEQIATLCRNLGDPQHSSME
GLRDSQDPPSRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFLTQ
DEXESLFGSLPEMLEFQKVFLETLEDGIAASSDFNILETPSQFRKLLFSLGGSFLYYADH
FKLYSGFCANHIKVQKVLERARTDRAFKAFLDARNPTKQHSSTLESFLIKPVQRVLKYPL
LLKELVSLTDHDSEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKE
VTELSMGELLTHSTVSWLNPLLSLGKTRKDLELTVFVFKRAVILVYKENCKLKKKSSSNS
RPAHGSADLDPFKFRWLIPISALQVRLGNAAGTENSSIWELIHTKSEVEGRPETIFQLCC
SDCESKTSIVKVIRSILRENFRSHIKCEQPLEKACKDRLVPLKNRVPVSAKLASSRSLKV
LRNSSSGEWPGEQGKGSSLDSDEGSLSSGTPSSCQDPPRHLPPGTADFPDGLVKESDILS
DEDEDGPRSLGKQASPTRDIEIQFQRLSISEEPDAQPSEGQPKLVRAHFCPIKRKANSTR
RDRGTLLRAQIRHQSLDSQPESAGLDLSSVLQREFSVQSLASVVNEECFYETESHAKS
Download sequence
Identical sequences ENSEEUP00000013482 ENSEEUP00000013482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]