SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013483 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013483
Domain Number 1 Region: 264-438
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-48
Family Protein kinases, catalytic subunit 0.0000022
Further Details:      
 
Domain Number 2 Region: 72-168
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-28
Family SH2 domain 0.00000376
Further Details:      
 
Domain Number 3 Region: 7-95
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000158
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013483   Gene: ENSEEUG00000014779   Transcript: ENSEEUT00000014776
Sequence length 460
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_100:3784:9067:-1 gene:ENSEEUG00000014779 transcript:ENSEEUT00000014776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRWAPGTQCVTKCEHTRPKPGQLAFHKGDVVTILEACESSWYRAKHHASEQEGLLAAGDL
REREALSADPRLSLMPWFHGKISGPEAVQQLQPPEDGLFLVRESTRHPGDYVLCVSFGRD
VVHYRVHHRAGCLTIDEDACFCNLMDMVEHYTRDQGAICTKLVKPRRKQGTRSAEEELAK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGNLVNFLRTRGRALVSTAQLVQFSLHVAEGMEYLEA
KKLVHRDLAARNILVSEDLVAKVSDFGLAKAERQGLDASRLPVKWTAPEALKHGKFSSKS
DVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPATVHVLMGGCWDAEP
ARRPPFHKLVEKLGRELRGMGTPVAPDPNSDSAAPPGLES
Download sequence
Identical sequences ENSEEUP00000013483 ENSEEUP00000013483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]