SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013527 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000013527
Domain Number - Region: 111-182
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00837
Family FCH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013527   Gene: ENSEEUG00000014837   Transcript: ENSEEUT00000014824
Sequence length 196
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8793:1114:78552:1 gene:ENSEEUG00000014837 transcript:ENSEEUT00000014824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQSSEAESRSNDLNSSVAPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTFPTNTKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSLLPEA
ERLEPFSMKPDREFKL
Download sequence
Identical sequences A0A1S3ATE6
XP_007540120.1.11023 ENSEEUP00000013527 ENSEEUP00000013527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]