SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013549 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013549
Domain Number 1 Region: 514-659
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-27
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 359-506
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-25
Family Laminin G-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013549
Domain Number - Region: 796-842
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000135
Family Laminin G-like module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013549   Gene: ENSEEUG00000014802   Transcript: ENSEEUT00000014849
Sequence length 955
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6207:6975:56615:1 gene:ENSEEUG00000014802 transcript:ENSEEUT00000014849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSLGPCALSLRADLRRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREDAASRSVSGPRVID
AKDGKDDDIEDGLDLDIPFKKASQPRRVERTGTGTGAALPAGLPGASCDEMVCPAGSSCM
PDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADA
DGLLLFCGDNEHGRGDFMSLAIIQRALQFRFNCGSGVAVITSESRIKLGTWNTVKLYRDG
VQGLLQVNNGTAVAGRSPGEYSKITFRTLYLGGPSAHLLARATGTCRGFHGCVRLLTVNG
KTLDMRPWPLGVALRGAEVGECSSGVCDEASCVNGGSCTASSADSYICLCPLGFKGRHCE
QGFTVVIPQFRESLKSYAVVSWPLGPDHYLSFMEFELTFRPDSGDGVLLYSYDLGSKDFV
SVNMVEGHVEFRFDCGSGTGTLRSPEPLTLGQWHELRVSRTGKNGILQVDTQKVVEGMAE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGNYCLNXXXXXXXXXXXXX
XXXXXXXXXXXXXXVSGSRTNVFMRFKTSAKDGLLLWRGAAPLRANSDFISLGLQKGSLV
FXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXGMKEVALRTDRRYTSGLVGCVSHFTLSADYHIDLVDDAGDGKNIKMCGAK
Download sequence
Identical sequences ENSEEUP00000013549 ENSEEUP00000013549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]