SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013569 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013569
Domain Number 1 Region: 18-178,220-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.73e-69
Family BAR domain 0.00091
Further Details:      
 
Domain Number 2 Region: 346-403
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000126
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013569   Gene: ENSEEUG00000014867   Transcript: ENSEEUT00000014869
Sequence length 404
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1235:76728:94859:-1 gene:ENSEEUG00000014867 transcript:ENSEEUT00000014869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPTAPYGKTLIKVAE
AEKRLGAAERDFIHTASINFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATVGEHTVPDFQETRPRNYILSASASALWNDEVEKAEQELRVAQTEFDRQAEVTR
LLLEGISSTHVNHLRCLHEFVESQTTYYAQCYRHLLDLQKQLGSSQGAIFPGTFVGTTEP
ASLPLSSTSPTTTAATMPLGPSGAGLVPRGEAALCLEEVAPPASGTRKARVLYDYEAADS
SELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Download sequence
Identical sequences ENSEEUP00000013569 ENSEEUP00000013569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]