SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013577 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013577
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-28
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 2 Region: 148-216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.64e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013577   Gene: ENSEEUG00000014890   Transcript: ENSEEUT00000014877
Sequence length 272
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_267654:5171:5989:1 gene:ENSEEUG00000014890 transcript:ENSEEUT00000014877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDYLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLNKRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQ
EWISHIEECVRRQLLATGRPPSTEHAAPWIPDKATDICMRCTQTRFSAITRRHHCRKCGF
VVCAECSRERFLLPRLSPKPLRVCSLCYRELAAQKQEEEEQGTGSPRQLAHLVGASSGDD
DDSDEDKEGGGDGDWPGQVKFYASNIWSSFHS
Download sequence
Identical sequences A0A1S3AR32
XP_007539511.1.11023 ENSEEUP00000013577 ENSEEUP00000013577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]