SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013702 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013702
Domain Number 1 Region: 279-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.28e-61
Family Protein kinases, catalytic subunit 0.00000000282
Further Details:      
 
Domain Number 2 Region: 168-308
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 108-193
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013702   Gene: ENSEEUG00000014995   Transcript: ENSEEUT00000015013
Sequence length 1183
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4606:8672:211908:-1 gene:ENSEEUG00000014995 transcript:ENSEEUT00000015013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQVGRVGEAPGLQPPPPRGIRGSSSARPSGRRRDLAGRTTEAGFNIFTQHXXXXXXXX
XXXXXXXXXXXXXXALHRPYGCDVESQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTTVVLLYMATQISSAMXXXXXXXXXXXDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPGYPLLSFQTRTLKKQVENKENIEGAQDTTE
NAASSSAPXXXXXXXXXXXXXXXXXXXRDKSPLSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSAASLQHADGFSFTPAQQETNMVPPKCYGG
SFAQRILCNDDGGGGGGSGSAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTCKPFPR
SNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRASDMLPPQTEEG
AAPARERSKAKLLPRGATALPVRTTSGDPAITEKDSPGPGVAGVAATPKSKERNGGSRLG
MAGVPEDGEQAGWSSPGKTAAALPTTHNHKVPVLISPTLKHTPADVQLIGTHLQGEQVQI
LFEHQVIFSGARDRPQRVKPKCAPPPPPVMRLLQHSSTCSDPAEESPAPPTAQLISGEAQ
NGGKKGVAGVLSTSGKAGRPGVPPPQVPQSTSSISPAKIANGTAGTKVALRKTRQATERI
SSDKISKEALLECADLLSSAIAEPMPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREA
VSKLEISLQELQVSSATATVPGANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences ENSEEUP00000013702 ENSEEUP00000013702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]