SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013737 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013737
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-38
Family Phosphotyrosine-binding domain (PTB) 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013737   Gene: ENSEEUG00000015057   Transcript: ENSEEUT00000015049
Sequence length 495
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_365964:4257:13030:-1 gene:ENSEEUG00000015057 transcript:ENSEEUT00000015049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVHWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSISVMEEPVIIT
RNSHPAELDLSRAPQTPNALGYTISSFSNGFPGCPGEGPRFSAPRRPSTSSLRHPSLGEE
STHALIAPDEQSHTYVNTPASEDDHRRSRHCLQPLPEGRVPFPPQTRAPDQRDPQVFLQP
GQVKFVLGPTPARRHMMKCQGMCPSLHDPSHHNNNNEGPSECPAQPKCTYENVSASLRRG
ADWRLSPEEPGWNGLAHRRAAFLHYENLPSLPPVWESQTQQLGEEAGDDGDSRDGLTPSS
NGFPDGEEDETPLQKPTSSRAALRSHSSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNY
IQVELKGWGGDRAKGPQNLSAPQNPVSTTYPTRSSDSYAVIDLKKTVAMSNLQRALPRDD
GTTRKTRHNSTDLPL
Download sequence
Identical sequences ENSEEUP00000013737 ENSEEUP00000013737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]