SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013800 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013800
Domain Number 1 Region: 45-133
Classification Level Classification E-value
Superfamily EF-hand 3.17e-25
Family S100 proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013800   Gene: ENSEEUG00000015128   Transcript: ENSEEUT00000015124
Sequence length 136
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_330662:766:6139:1 gene:ENSEEUG00000015128 transcript:ENSEEUT00000015124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GETPETKIFSECCPARTLAAFPAPVSVYPEPTLTSGRGPTSTMSSDLETAMETLINVFHT
HSGKEGDKYKLSKKELKELLQVEFSGFLECQKDAEAVDKLMKELDENGDGEVDFQEYVVM
VAALTVACNNFFWENS
Download sequence
Identical sequences ENSEEUP00000013800 ENSEEUP00000013800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]